| Entry |
Dermaseptin-L1 |
| Peptide names |
Dermaseptin-L1 |
| Suborder |
Neobatrachia |
| Family |
Hylidae |
| Genus |
Hylomantis |
| Species |
Hylomantis lemur |
| Ecozone |
Neotropic |
| Distribution |
Moderate elevations in Costa Rica and Panama and just across the border to Colombia |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
|
| Length |
32 |
| References: |
| 1. for MIC/HC50 |
J.M. Conlon et al. / Toxicon 50 (2007) 498-506. Peptides with differential cytolytic activity from skin secretions of the lemur leaf frog Hylomantis lemur (Hylidae: Phyllomedusinae) |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Bioactive | Dermaseptin-L1 | 32 | No | GLWSKIKEAAKAAGKAALNAVTGLVNQGDQPS | 200 | 8 | >128.00 |
|