Esculentin-2PRb

Entry Esculentin-2PRb
Peptide names Esculentin-2PRb
Suborder Neobatrachia
Family Ranidae
Genus Rana
Species Rana pretiosa
Ecozone Nearctic
Distribution Northwestern Washington and adjacent Britsh Columbia (Canada), and the Cascade Mountains of Oregon and adjacent California, USA. Now extinct in Canada and most of western Washington and western Oregon
Antimicrobial & other activities antibacterial, antifungal
Tissue Skin
Sequence
Length 37
References:
1. for MIC/HC50 J.M. Conlon et al. / Developmental and Comparative Immunology 35 (2011) 644-649. Host defense peptides in skin secretions of the Oregon spotted frog Rana pretiosa: implications for species resistance to chytridiomycosis


Segment type Name Length Amidated Sequence HC50 (μM) MIC E. coli (μM) MIC S. aureus (μM)
BioactiveEsculentin-2PRb37NoGIFSALAAGVKLLGNTLFKMAGKAGAEHLACKATNQC352512.5