Odorranain-E1

Entry Odorranain-E1
Peptide names Odorranain-E1
Suborder Neobatrachia
Family Ranidae
Genus Odorrana
Species Odorrana grahami
Ecozone Palearctic, Indomalaya
Distribution Sichuan, Guizhou, and central and western Yunnan, China; a distantly alloparic population present in southern Shanxi, China: presumably to be found in eastern Myanmar along the Yunna, China, border; reported in Lao Cai and Lai Chau provinces, Vietnam, 1150-3200 m elevation
Antimicrobial & other activities antibacterial, antifungal, mast cell degranulation, histamine releasing
Tissue Skin
Sequence
Length 32
References:
1. for MIC/HC50 J. Li et al. / Molecular & Cellular Proteomics 6 (2007) 882-894. Anti-infection Peptidomics of Amphibian Skin


Segment type Name Length Amidated Sequence HC50 (μM) MIC E. coli (μM) MIC S. aureus (μM)
BioactiveOdorranain-E132NoGLGGAKKNFIIAANKTAPQSVKKTFSCKLYNG 2.791.39