Esculentin-1ARb

Entry Esculentin-1ARb
Peptide names Esculentin-1ARb
Suborder Neobatrachia
Family Ranidae
Genus Lithobates
Species Lithobates areolatus
Ecozone Nearctic
Distribution East Texas and western Louisiana north through eastern Oklahoma (with an extension into central Arkansas) to eastern Kansas through Missouri to southeastern Iowa, thence east to southwestern Indiana, then south generally east of the Mississippi River to western Kentucky, western Tennessee and much of Mississippi. Absent from the Ozarks of Missouri and Arkansas and local throughout southern Arkansas and northern Louisiana, USA.
Antimicrobial & other activities antibacterial
Tissue Skin
Sequence
Length 46
References:
1. for MIC/HC50 M.F. Ali et al. / Biochimica et Biophysica Acta 1601 (2002) 55-63. Antimicrobial peptides and protease inhibitors in the skin secretions of the crawfish frog, Rana areolata


Segment type Name Length Amidated Sequence HC50 (μM) MIC E. coli (μM) MIC S. aureus (μM)
BioactiveEsculentin-1ARb46NoGLFPKFNKKKVKTGIFDIIKTVGKEAGMDVLRTGIDVIGCKIKGEC120360