| Entry |
Odorranin-L-OH1 |
| Peptide names |
Odorranin-L-OH1 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Odorrana |
| Species |
Odorrana hejiangensis |
| Ecozone |
Palearctic |
| Distribution |
Yangtze River Valley in Hejiang County, Sichuan, China |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MFTLKKSLLLLFFLGTISLSVCEQERDADEEGNEENRVEVQVRDVGTQGLSPLRQPAP
|
| Length |
58 |
| Signal peptide class |
Class-1 |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
22 |
|
MFTLKKSLLLLFFLGTISLSVC |
| | |
| Prepro | | 21 | | EQERDADEEGNEENRVEVQVR | | | | | Bioactive | Odorranin-L-OH1 | 15 | No | DVGTQGLSPLRQPAP | | | |
|