| Entry |
Odorranain-U-OA1 |
| Peptide names |
Nigroain-E Nigroain-E1 Nigroain-E-RA Odorranain-U-OA1 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Odorrana |
| Species |
Odorrana andersonii |
| Ecozone |
Indomalaya |
| Distribution |
Northeastern India, Upper Myanmar, and northern Thailand to western Yunnan, China; south into Vietnam and Laos |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MFTMKKSLLLLFFLGTISLSLCEQERDADEEENEENGEEAKLEVVKRDCTRWIIGINGRI
CRD
|
| Length |
63 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
Y. Ma et al. / Genomics 95 (2010) 66-71. Peptidomics and genomics analysis of novel antimicrobial peptides from the frog, Rana nigrovittata |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
22 |
|
MFTMKKSLLLLFFLGTISLSLC |
| | |
| Prepro | | 25 | | EQERDADEEENEENGEEAKLEVVKR | | | | | Bioactive | Odorranain-U-OA1 | 16 | No | DCTRWIIGINGRICRD | | | 9.92 |
|