| Entry |
Andersonin-Q1 |
| Peptide names |
Andersonin-Q1 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Odorrana |
| Species |
Odorrana andersonii |
| Ecozone |
Indomalaya |
| Distribution |
Northeastern India, Upper Myanmar, and northern Thailand to western Yunnan, China; south into Vietnam and Laos |
| Antimicrobial & other activities |
inhibition of IL-8 production, insulin releasing |
| Tissue |
Skin |
| Sequence |
MFTLKKPLLLLFFLGTINLSLCEEEERDIDQEERRDDPEERDVEVEKREMLKKKKEVKME RKT
|
| Length |
63 |
| Signal peptide class |
Class-1 |
| References: |
| 2. for other activities |
X. Yang et al. / Journal of Proteome Research 11 (2012) 306-319. Extremely Abundant Antimicrobial Peptides Existed in the Skins of Nine Kinds of Chinese Odorous Frogs |