Entry |
Andersonin-R1 |
Peptide names |
Andersonin-R1 |
Suborder |
Neobatrachia |
Family |
Ranidae |
Genus |
Odorrana |
Species |
Odorrana andersonii |
Ecozone |
Indomalaya |
Distribution |
Northeastern India, Upper Myanmar, and northern Thailand to western Yunnan, China; south into Vietnam and Laos |
Antimicrobial & other activities |
antioxidant, inhibition of IL-8 production |
Tissue |
Skin |
Sequence |
MFTMKKSLLLLFFLGTISLSLCEQERDAEEEERRENAEEDIVLMENLFCSYIVGSADSFW T
|
Length |
61 |
Signal peptide class |
Class-1 |
References: |
2. for other activities |
X. Yang et al. / Journal of Proteome Research 11 (2012) 306-319. Extremely Abundant Antimicrobial Peptides Existed in the Skins of Nine Kinds of Chinese Odorous Frogs |