| Entry |
Hejiangin-E1 |
| Peptide names |
Hejiangin-E1 Andersonin-R Andersonin-L1 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Odorrana |
| Species |
Odorrana hejiangensis |
| Ecozone |
Palearctic |
| Distribution |
Yangtze River Valley in Hejiang County, Sichuan, China |
| Antimicrobial & other activities |
antioxidant |
| Tissue |
Skin |
| Sequence |
MFTLKKSLLLLFFIGMISLSLCEQERDADEEENGVEDKVEDIKRSADQTGMNKAALSPIR
FISKSV
|
| Length |
66 |
| Signal peptide class |
Class-1 |
| References: |
| 2. for other activities |
X. Yang et al. / Journal of Proteome Research 11 (2012) 306-319. Extremely Abundant Antimicrobial Peptides Existed in the Skins of Nine Kinds of Chinese Odorous Frogs |