| Entry |
Lividin-D1 |
| Peptide names |
Lividin-D1 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Odorrana |
| Species |
Odorrana livida |
| Ecozone |
Indomalaya |
| Distribution |
Known definitely only from the type locality (Myanmar) near the Thai border, although animals have been referred, apparently in error, to this taxon, from northeastern India to southern China |
| Antimicrobial & other activities |
antioxidant, inhibition of IL-8 production |
| Tissue |
Skin |
| Sequence |
MFTLKKSLLLLFFLGTINLSLCQERIMPKKKEEMIQMKSILKRKNNFCQVLYVWLLRLGK
QCFVKFSKDVET
|
| Length |
72 |
| Signal peptide class |
Class-1 |
| References: |
| 2. for other activities |
X. Yang et al. / Journal of Proteome Research 11 (2012) 306-319. Extremely Abundant Antimicrobial Peptides Existed in the Skins of Nine Kinds of Chinese Odorous Frogs |