| Entry |
Macrotympanain-A1 |
| Peptide names |
Macrotympanain-A1 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Odorrana |
| Species |
Odorrana macrotympana |
| Ecozone |
Indomalaya |
| Distribution |
Irrawady drainages in Yunna, particularly in the Yinjiang region, China; presumably to be found in adjacent northern Myanmar |
| Antimicrobial & other activities |
antioxidant, inhibition of TNF-alpha production |
| Tissue |
Skin |
| Sequence |
MFTLKKSLLLLFFLGTINLSLCQEETNAEEERRDDPNEMDAEGTVQKRFLPGLECVW
|
| Length |
57 |
| Signal peptide class |
Class-1 |
| References: |
| 2. for other activities |
X. Yang et al. / Journal of Proteome Research 11 (2012) 306-319. Extremely Abundant Antimicrobial Peptides Existed in the Skins of Nine Kinds of Chinese Odorous Frogs |