| Entry |
Macrotympanain-D1 |
| Peptide names |
Macrotympanain-D1 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Odorrana |
| Species |
Odorrana macrotympana |
| Ecozone |
Indomalaya |
| Distribution |
Irrawady drainages in Yunna, particularly in the Yinjiang region, China; presumably to be found in adjacent northern Myanmar |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MFTLKKPPLLLPFLGMISFSFFEQAKTDEEERRKGKEEEGKKKALKRRWTKQIPPNQCSG
KKKNKNGKSFN
|
| Length |
71 |
| Signal peptide class |
Class-1 |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
22 |
|
MFTLKKPPLLLPFLGMISFSFF |
| | |
| Prepro | | 25 | | EQAKTDEEERRKGKEEEGKKKALKR | | | | | Bioactive | Macrotympanain-D1 | 24 | No | RWTKQIPPNQCSGKKKNKNGKSFN | | | |
|