Esculentin-2-OR5

Entry Esculentin-2-OR5
Peptide names Esculentin-2-OR5
Suborder Neobatrachia
Family Ranidae
Genus Odorrana
Species Odorrana rotodora
Ecozone Indomalaya
Distribution Nonghun, Ruili, Yingjiang, Menglian, Puer, and Lancang, Yunnan, China, 400?810 m elevation
Antimicrobial & other activities antibacterial, antifungal
Tissue Skin
Sequence
Length 37
References:
1. for MIC/HC50 X. Yang et al. / Journal of Proteome Research 11 (2012) 306-319. Extremely Abundant Antimicrobial Peptides Existed in the Skins of Nine Kinds of Chinese Odorous Frogs


Segment type Name Length Amidated Sequence HC50 (μM) MIC E. coli (μM) MIC S. aureus (μM)
BioactiveEsculentin-2-OR537NoGVFTLIKGATQLIGKTLGKELGKTGLEIMACKITKQC 4.064.06