| Entry |
OGTI precursor AT-21 |
| Peptide names |
OGTI Ranatuerin-2SHb Ranatuerin-2R-RA2 Ranatuerin-2-MG1 Andersonin-W2 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Odorrana |
| Species |
Odorrana grahami |
| Ecozone |
Palearctic, Indomalaya |
| Distribution |
Sichuan, Guizhou, and central and western Yunnan, China; a distantly alloparic population present in southern Shanxi, China: presumably to be found in eastern Myanmar along the Yunna, China, border; reported in Lao Cai and Lai Chau provinces, Vietnam, 1150-3200 m elevation |
| Antimicrobial & other activities |
antibacterial, serine protease inhibitor |
| Tissue |
Skin |
| Sequence |
MFTMKKSLLLLFFLGFISLSLCEEERDANEERRDDPDENEANEGEAKVEEIKRAVNIPFK
VHFRCKAAFC
|
| Length |
70 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
X. Yang et al. / Journal of Proteome Research 11 (2012) 306-319. Extremely Abundant Antimicrobial Peptides Existed in the Skins of Nine Kinds of Chinese Odorous Frogs |
| 2. for other activities |
J. Li et al. / Biochimie 90 (2008) 1356-1361. A small trypsin inhibitor from the frog of Odorrana grahami |