Histone 2A

Entry Histone 2A
Genbank code AAB36002
Peptide names Buforin 2 Buforin II Histone 2A Histone H2A
Suborder Neobatrachia
Family Bufonidae
Genus Bufo
Species Bufo gargarizans
Ecozone Palearctic
Distribution Amur River basin and Sakhalin island, Russia; Korean Peninsula; eastern and northeastern China south through central and eastern China to eastern Sichuan, Yunnan, Fujian, and nrothern Guanxi; Miyakojima, Ryukyu island., Japan; introduced onto the islands of Kita Daitojima and Minami Daitojima and into the northern part of Okinawa
Antimicrobial & other activities antibacterial, DNA binding, anticancer, antifungal, anti-endotoxin
Tissue Stomach
Sequence AGRGKQGGKVRAKAKTRSSRAGLQFPVGRVHRLLRKGNY
Length 39
References:
1. for MIC/HC50 C.B. Park et al. / Proc. Natl. Acad. Sci. USA 97 (2000) 8245-8250. Structure-activity analysis of buforin II, a histone H2A-derived antimicrobial peptide: the proline hinge is responsible for the cell-penetrating ability of buforin II


Segment type Name Length Amidated Sequence HC50 (μM) MIC E. coli (μM) MIC S. aureus (μM)
BioactiveBuforin 221NoTRSSRAGLQFPVGRVHRLLRK>330.001.61.6