Entry |
Preprohainanenin-5 |
Peptide names |
Hainanenin-5 |
Suborder |
Neobatrachia |
Family |
Ranidae |
Genus |
Amolops |
Species |
Amolops hainanensis |
Ecozone |
Indomalaya |
Distribution |
High-gradient streams in southwestern and central Hainan Island, China, 80-960 m elevation |
Antimicrobial & other activities |
antibacterial, antifungal |
Tissue |
Skin |
Sequence |
MFTMKKSMLLLFFLGTINLSLCEQQRDAEEERRDDEDKRDVEVEKRFALGAVTKRLPSLF CLITRKC
|
Length |
67 |
Signal peptide class |
Class-1 |
References: |
1. for MIC/HC50 |
S. Zhang et al. / Peptides (2012) Hainanenins: a novel family of antimicrobial peptides with strong activity from Hainan cascade-frog Amolops hainanensis, Available online 24 January 2012 |