| Entry | bombesin-related protein precursor |
| Genbank code | 20086752 |
| Peptide names | PR-bombesin |
| Suborder | Archeobatrachia |
| Family | Bombinatoridae |
| Genus | Bombina |
| Species | Bombina maxima |
| Ecozone | Palearctic, Indomalaya |
| Distribution | Yunnan, southwestern Sichuan, Hubei, Guizhou, and northern Guangxi, China; adjacent northern Vietnam |
| Antimicrobial & other activities | smooth muscle contraction |
| Tissue | Skin |
| Sequence | MSAIPLNRILPLGFLFCLLLSSFISLSSCMEFVEDANNQGRISLQKKPPRPPQWAVGHFM GKKSLQDMDFEEMGSFAKRSVEKIRAALLQEQQGAGSERELRHAQLVAREILAQYLENMQ N |
| Length | 121 |
| Signal peptide class | Class-6 |
| References: | |
| 2. for other activities | R. Lai et al. / Peptides 23 (2002) 437-442. A novel proline rich bombesin-related peptide (PR-bombesin) from toad Bombina maxima |
| Segment type | Name | Length | Amidated | Sequence | HC50 (μM) | MIC E. coli (μM) | MIC S. aureus (μM) |
| Signal | 29 | MSAIPLNRILPLGFLFCLLLSSFISLSSC | |||||
| Prepro | 15 | MEFVEDANNQGRISL | |||||
| Bioactive | PR-bombesin | 16 | Yes | QKKPPRPPQWAVGHFM |