| Entry |
Brevinin-2GHb |
| Uniprot code |
A0AEI5 |
| Fasta |
A0AEI5 |
| Peptide names |
Brevinin-2GHb |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Hylarana |
| Species |
Hylarana guentheri |
| Ecozone |
Indomalaya |
| Distribution |
Central Vietnam throughout southern China (north to Yangtze River), including Hainan and Taiwan; introduced onto Guam |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MFTMKKSLLLLFFLGTVSLSLCEQERGADEDDGGEMTEELKRGVITDALKGAAKTVAAEL
LRKAHCKLTNSC
|
| Length |
72 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
J. Zhou et al. / Peptides 27 (2006) 3077-3084. Purification and characterization of novel antimicrobial peptides from the skin secretion of Hylarana guentheri |