Entry |
Brevinin-2GHc |
Uniprot code |
A0AEI6 |
Fasta |
A0AEI6 |
Peptide names |
Brevinin-2GHc |
Suborder |
Neobatrachia |
Family |
Ranidae |
Genus |
Hylarana |
Species |
Hylarana guentheri |
Ecozone |
Indomalaya |
Distribution |
Central Vietnam throughout southern China (north to Yangtze River), including Hainan and Taiwan; introduced onto Guam |
Antimicrobial & other activities |
antibacterial |
Tissue |
Skin |
Sequence |
MFTMKKSLLLLFFLGMISLSLCEQERGADEDEGEVEEQIKRSIWEGIKNAGKGFLVSILD KVRCKVAGGCNP
|
Length |
72 |
Signal peptide class |
Class-1 |
References: |
1. for MIC/HC50 |
J. Zhou et al. / Peptides 27 (2006) 3077-3084. Purification and characterization of novel antimicrobial peptides from the skin secretion of Hylarana guentheri |