| Entry |
Bradykinin-like protein |
| Uniprot code |
A0EX85 |
| Fasta |
A0EX85 |
| Peptide names |
Bradykinin-like protein |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Amolops |
| Species |
Amolops loloensis |
| Ecozone |
Palearctic |
| Distribution |
High-gradients streams in Zhaojue, Mianning, Hongya, Luding, and Baoxing in southern Sichuan, China, 1840-3700 m elevation |
| Antimicrobial & other activities |
myotropic effect on ileum cells |
| Tissue |
Skin |
| Sequence |
MFTLKESLLLLFFLGAISLSLCEQERDADEEETEGGAKVETVKRAPVPPGFTPFRVAPEI
V
|
| Length |
61 |
| Signal peptide class |
Class-1 |
| References: |
| 2. for other activities |
J. Liang et al. / Peptides 27 (2006) 2683-2687. A novel bradykinin-like peptide from skin secretions of rufous-spotted torrent frog, Amolops loloensis |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
22 |
|
MFTLKESLLLLFFLGAISLSLC |
| | |
| Prepro | | 22 | | EQERDADEEETEGGAKVETVKR | | | | | Bioactive | Bradykinin-like protein | 9 | No | VPPGFTPFR | | | |
|