| Entry |
Preprotemporin-1SKa |
| Uniprot code |
A1IKN3 |
| Fasta |
A1IKN3 |
| Peptide names |
Preprotemporin-1SKa Temporin-1SKa |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Rana |
| Species |
Rana sakuraii |
| Ecozone |
Palearctic |
| Distribution |
Montane regions of central Honshu from Kanto through Chubu to Kinki Districts, Japan |
| Antimicrobial & other activities |
antibacterial, antifungal |
| Tissue |
Skin |
| Sequence |
MFTLKKSLLLLFFLGTINLSLCEEERNAEEERRDDPEERDVEVEKRFLPVILPVIGKLLN
GILGK
|
| Length |
65 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
H. Suzuki et al. / Peptides 28 (2007) 505-514. Expression of genes encoding antimicrobial and bradykinin-related peptides in skin of the stream brown frog Rana sakuraii |