| Entry |
Preprotemporin-1SKc |
| Uniprot code |
A1IKN4 |
| Fasta |
A1IKN4 |
| Peptide names |
Preprotemporin-1SKc |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Rana |
| Species |
Rana sakuraii |
| Ecozone |
Palearctic |
| Distribution |
Montane regions of central Honshu from Kanto through Chubu to Kinki Districts, Japan |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MFTLKKSLLLLFFLGIINLSLCEEERDADEEERRDDPEEGDVEVEKRAVDLAKIANIANK VLSSLFGK
|
| Length |
68 |
| Signal peptide class |
Class-1 |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
22 |
|
MFTLKKSLLLLFFLGIINLSLC |
| | |
| Prepro | | 25 | | EEERDADEEERRDDPEEGDVEVEKR | | | | | Bioactive | Preprotemporin-1SKc | 19 | No | AVDLAKIANIANKVLSSLF | | | |
|