| Entry |
Preprotemporin-1Oe1 |
| Uniprot code |
A3KD28 |
| Fasta |
A3KD28 |
| Peptide names |
Preprotemporin-1Oe1 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Rana |
| Species |
Rana ornativentris |
| Ecozone |
Palearctic |
| Distribution |
Honshu, Shikoku, and Kyushu Islands as well as some outlying islands, Japan |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MFTLKKSLLLLFFLGTINFSLCEEERNAEEERRDDPEERDVAVEKRILPLLGNLLNGLLG K
|
| Length |
61 |
| Signal peptide class |
Class-1 |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
22 |
|
MFTLKKSLLLLFFLGTINFSLC |
| | |
| Prepro | | 24 | | EEERNAEEERRDDPEERDVAVEKR | | | | | Bioactive | Preprotemporin-1Oe1 | 13 | No | ILPLLGNLLNGLL | | | |
|