Entry |
Temporin-1PLa |
Uniprot code |
A7WNV7 |
Fasta |
A7WNV7 |
Peptide names |
Temporin-1AM Temporin-1PLa Temporin-1V |
Suborder |
Neobatrachia |
Family |
Ranidae |
Genus |
Lithobates |
Species |
Lithobates palustris |
Ecozone |
Palearctic |
Distribution |
Eastern North America, from southern Quebec through southern Ontario (Canada) south through extreme eastern Minnesota and on to East Texas then east to South Carolina (USA), extreme western Florida, and north to Nova Scotia (Canada) |
Antimicrobial & other activities |
antibacterial |
Tissue |
Skin |
Sequence |
MFTSKKSLLLLFFLGTINLSLCEEERDADEEERRDDPDEMNVEVEKRFLPLVGKILSGLI GK
|
Length |
62 |
Signal peptide class |
Class-1 |
References: |
1. for MIC/HC50 |
Y.J. Basir et al. / Biochimica et Biophysica Acta 1543 (2000) 95-105. Multiple antimicrobial peptides and peptides related to bradykinin and neuromedin N isolated from skin secretions of the pickerel frog, Rana palustris |