Entry |
Pleurain-A2 |
Uniprot code |
A8B5P0 |
Fasta |
A8B5P0 |
Peptide names |
Pleurain-A2 |
Suborder |
Neobatrachia |
Family |
Ranidae |
Genus |
Babina |
Species |
Babina pleuraden |
Ecozone |
Palearctic, Indomalaya |
Distribution |
Yunnan, Sichuan, and Guizhou (Yunkwei Plateau), China; likely in adjacent northern Myanmar |
Antimicrobial & other activities |
antibacterial, antifungal |
Tissue |
Skin |
Sequence |
MFTLKKTLLLLYFLGTISISLCKQERDADEDDGRKMTEEEVKRSIITMTKEAKLPQSWKQ IACRLYNTC
|
Length |
69 |
Signal peptide class |
Class-1 |
References: |
1. for MIC/HC50 |
X. Wang et al. / Peptides 28 (2007) 2069-2074. A new family of antimicrobial peptides from skin secretions of Rana pleuraden |
Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
Signal |
|
22 |
|
MFTLKKTLLLLYFLGTISISLC |
| | |
Prepro | | 21 | | KQERDADEDDGRKMTEEEVKR | | | | Bioactive | Pleurain-A2 | 26 | No | SIITMTKEAKLPQSWKQIACRLYNTC | | 19.84 | 4.96 |
|