| Entry | Temporin-1P |
| Uniprot code | B0B2H3 |
| Fasta | B0B2H3 |
| Peptide names | Amolopin-2b Temporin-1CSa Temporin-GN3 Temporin-GN3_1 Temporin-LF3 Temporin-GN3_2 Temporin-1P Temporin-MT3 |
| Suborder | Neobatrachia |
| Family | Ranidae |
| Genus | Lithobates |
| Species | Lithobates pipiens |
| Ecozone | Nearctic |
| Distribution | Southern Canada (southeastern British Columbia to southern Northern Territory east to Labrador and Nova Scotia) south through eastern Washington eastern Oregon, Nevada and adjacent California to northern Arizona, northern New Mexico (with islolated populations along the Rio Grande south to Las Cruces), thence east-northeast to central Nebraska, Ohio, northern Kentucky, West Virginia, and New England, USA |
| Antimicrobial & other activities | antibacterial |
| Tissue | Skin |
| Sequence | MFTLKKSLLLLFFLGTINLSLCEEERDADEEERRDDSDESNVEVEKRFLPIVGKLLSGLL GK |
| Length | 62 |
| Signal peptide class | Class-1 |
| References: | |
| 1. for MIC/HC50 | J.M. Conlon et al. / Peptides 28 (2007) 1268-1274. Peptide defenses of the Cascades frog Rana cascadae: implications for the evolutionary history of frogs of the Amerana species group |
| Segment type | Name | Length | Amidated | Sequence | HC50 (μM) | MIC E. coli (μM) | MIC S. aureus (μM) |
| Signal | 22 | MFTLKKSLLLLFFLGTINLSLC | |||||
| Prepro | 25 | EEERDADEEERRDDSDESNVEVEKR | |||||
| Bioactive | Temporin-1P | 13 | Yes | FLPIVGKLLSGLL | 75 | 128 | 8 |