| Entry |
Nigrocin-2H |
| Uniprot code |
B0B2H4 |
| Fasta |
B0B2H4 |
| Peptide names |
Nigrocin-2 Nigrocin-2H Nigrocin-2P |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Odorrana |
| Species |
Odorrana hejiangensis |
| Ecozone |
Palearctic |
| Distribution |
Yangtze River Valley in Hejiang County, Sichuan, China |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MFTLKKSLLLLFFLGMVSLALCEQERDANEEERRDELDERDVEAIKRGLLSKVLGVGKKV
LCGVSGLC
|
| Length |
68 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
L. Wang et al. / FEBS Journal 277 (2010) 1519-1531. Nigrocin-2 peptides from Chinese Odorrana frogs - integration of UPLC/MS/MS with molecular cloning in amphibian skin peptidome analysis |