| Entry |
Temporin-1AM |
| Uniprot code |
B0B2H5 |
| Fasta |
B0B2H5 |
| Peptide names |
Temporin-1AM Temporin-1PLa Temporin-1V |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Rana |
| Species |
Rana amurensis |
| Ecozone |
Palearctic |
| Distribution |
Western Siberia east to Sakhalin Island, northern and eastern Mongolia, northeastern China and North Korea, north to beyond the Arctic Circle (northernmost 71 degrees N) |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MFTLKKSLLLLFFLGTINLSLCEEERDADEEERRDDPDEMNVEVEKRFLPLVGKILSGLI
GK
|
| Length |
62 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
Y.J. Basir et al. / Biochimica et Biophysica Acta 1543 (2000) 95-105. Multiple antimicrobial peptides and peptides related to bradykinin and neuromedin N isolated from skin secretions of the pickerel frog, Rana palustris |