| Entry | Bowman-Birk trypsin inhibitor |
| Uniprot code | B1VC43 |
| Fasta | B1VC43 |
| Peptide names | Bowman-Birk trp inhibitor Bowman-Birk trypsin inhibitor |
| Suborder | Neobatrachia |
| Family | Ranidae |
| Genus | Odorrana |
| Species | Odorrana versabilis |
| Ecozone | Indomalaya |
| Distribution | Southeastern China, from southern Anhui Jiangxi, and northern Guangdong west to Guizhou |
| Antimicrobial & other activities | trypsin inhibitor |
| Tissue | Skin |
| Sequence | MFTLKKSLLLLFFLGTISLSLCEQERDSDDEDQGEVTEQVVKRSVIGCWTKSIPPRPCFV KG |
| Length | 62 |
| Signal peptide class | Class-1 |
| References: | |
| 2. for other activities | G. Song et al. / BBRC 372 (2008) 191-196. HV-BBI--a novel amphibian skin Bowman-Birk-like trypsin inhibitor |
| Segment type | Name | Length | Amidated | Sequence | HC50 (μM) | MIC E. coli (μM) | MIC S. aureus (μM) |
| Signal | 22 | MFTLKKSLLLLFFLGTISLSLC | |||||
| Prepro | 21 | EQERDSDDEDQGEVTEQVVKR | |||||
| Bioactive | Bowman-Birk trp inhibitor | 18 | No | SVIGCWTKSIPPRPCFVK |