| Entry |
Kininogen-2 |
| Uniprot code |
B2FUW3 |
| Fasta |
B2FUW3 |
| Peptide names |
RR-13 Kininogen-2 bradykinin |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Rana |
| Species |
Rana chensinensis |
| Ecozone |
Palearctic |
| Distribution |
Eastern Mongolia; north-central China (Shanxi) south to Sichuan and Hubei |
| Antimicrobial & other activities |
contraction of small intestine smooth muscle cells, relaxation of arterial smooth muscle cells |
| Tissue |
Skin |
| Sequence |
MFTLKKSLLLLFFLGTISLSLCEQERDADEDEYAGDAKAEDVKRAGYSRVISLPAGLSPL
RIAPASSRMIRRPPGFSPFRIAPAIV
|
| Length |
86 |
| Signal peptide class |
Class-1 |
| References: |
| 2. for other activities |
T. Chen et al. / Peptides 23 (2002) 1547-1555. Bradykinins and their precursor cDNAs from the skin of the fire-bellied toad (Bombina orientalis) |