| Entry |
Preprobrevinin-1Ja |
| Uniprot code |
B3IWN0 |
| Fasta |
B3IWN0 |
| Peptide names |
Preprobrevinin-1Ja |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Rana |
| Species |
Rana japonica |
| Ecozone |
Palearctic |
| Distribution |
Japan (Honshu, Kyushu, and Shikoku Islands, as well as the Tanegashima Group) |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MFTLKKSMLLLFFLGTISLSLGEEERDANEEEENGGEVKEEDKRFLGSLIGAAIPAIKQL
LGLKK
|
| Length |
65 |
| Signal peptide class |
Class-1 |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
22 |
|
MFTLKKSMLLLFFLGTISLSLG |
| | |
| Prepro | | 22 | | EEERDANEEEENGGEVKEEDKR | | | | | Bioactive | Preprobrevinin-1Ja | 21 | No | FLGSLIGAAIPAIKQLLGLKK | | | |
|