| Entry |
Caerin 1.1 |
| Uniprot code |
B5AKW4 |
| Fasta |
B5AKW4 |
| Peptide names |
Caerin-1.1 Caerin 1.1 |
| Suborder |
Neobatrachia |
| Family |
Hylidae |
| Genus |
Litoria |
| Species |
Litoria caerulea |
| Ecozone |
Australasia |
| Distribution |
Northern and eastern Australia (except for the Victoria and Tasmania); islands in the Torres Straits; New Guinea (northern lowlands, southern lowlands, and Vogelkop Peninsula); introduced into New Zealand |
| Antimicrobial & other activities |
antibacterial, anticancer, antifungal, nNOS inhibitor |
| Tissue |
Skin |
| Sequence |
MAFLKKSLFLVLFLGFVSVSICEEEKRQEDEDEHVEEGENQEEGSEEKRGLLSVLGSVAK
HVLPHVVPVIAEHLG
|
| Length |
75 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
M.A. Apponyi et al. / Peptides 25 (2004) 1035-1054. Host-defence peptides of Australian anurans: structure, mechanism of action and evolutionary significance; P.A. Wabnitz et al. / European Journal of Biochemistry 267 (2000) 269-275. Differences in the skin peptides of the male and female Australian tree frog Litoria splendida. The discovery of the aquatic male sex pheromone splendipherin, together with phe8 caerulein and a new antibiotic peptide caerin 1.10 |
| 2. for other activities |
R.J. Jackway et al. / Peptides 32 (2011) 161-172. Skin peptide and cDNA profiling of Australian anurans: genus and species identification and evolutionary trends |