| Entry | Maximin 25 |
| Uniprot code | B5L0Z8 |
| Fasta | B5L0Z8 |
| Peptide names | Maximin 25 Maximin 3 |
| Suborder | Archeobatrachia |
| Family | Bombinatoridae |
| Genus | Bombina |
| Species | Bombina maxima |
| Ecozone | Palearctic, Indomalaya |
| Distribution | Yunnan, southwestern Sichuan, Hubei, Guizhou, and northern Guangxi, China; adjacent northern Vietnam |
| Antimicrobial & other activities | antibacterial, antifungal, anticancer, anti-HIV-1, spermicidal |
| Tissue | Skin, Brain |
| Sequence | MNFKYIVAVSFLIASAYARSVQNDEQSLSQRDVLEEESLREIRGIGGKILSGLKTALKGA AKELASTYLHRKRTAEEHEVMKRLEAVMRDLDSLDYPEEASERETRGFNQDEIANLFTKK EKRIWGQY |
| Length | 128 |
| Signal peptide class | Class-3 |
| References: | |
| 1. for MIC/HC50 | R. Liu et al. / Journal of Proteome Research 10 (2011) 1806-1815. There are abundant antimicrobial peptides in brains of two kinds of Bombina toads |
| 2. for other activities | R. Lai et al. / Peptides 23 (2002) 427-435. Antimicrobial peptides from skin secretions of Chinese red belly toad Bombina maxima |
| Segment type | Name | Length | Amidated | Sequence | HC50 (μM) | MIC E. coli (μM) | MIC S. aureus (μM) |
| Signal | 18 | MNFKYIVAVSFLIASAYA | |||||
| Prepro | 25 | RSVQNDEQSLSQRDVLEEESLREIR | |||||
| Bioactive | Maximin 25 | 27 | Yes | GIGGKILSGLKTALKGAAKELASTYLH | 100 | 3.5 | 1.74 |