| Entry |
Pleurain-B2 |
| Uniprot code |
B5L1B8 |
| Fasta |
B5L1B8 |
| Peptide names |
Pleurain-B2 Pleurain-B4 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Babina |
| Species |
Babina pleuraden |
| Ecozone |
Palearctic, Indomalaya |
| Distribution |
Yunnan, Sichuan, and Guizhou (Yunkwei Plateau), China; likely in adjacent northern Myanmar |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MFTMKKSLLLLFFLGTINLSLCEEERNAEEERRDDPDERDVEVEKRFLGGLLSGIFKHLG KK
|
| Length |
62 |
| Signal peptide class |
Class-1 |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
22 |
|
MFTMKKSLLLLFFLGTINLSLC |
| | |
| Prepro | | 24 | | EEERNAEEERRDDPDERDVEVEKR | | | | | Bioactive | Pleurain-B2 | 16 | No | FLGGLLSGIFKHLGKK | | | |
|