| Entry |
Preprofallaxidin-1 |
| Uniprot code |
B5LUQ4 |
| Fasta |
B5LUQ4 |
| Peptide names |
Fallaxidin-4.1 Preprofallaxidin-1 |
| Suborder |
Neobatrachia |
| Family |
Hylidae |
| Genus |
Litoria |
| Species |
Litoria fallax |
| Ecozone |
Australasia |
| Distribution |
Coastal southwestern Queensland into northeastern New South Wales, Australia; introduced on Guam |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MASLKKSLFLVLFLGMVSLSICDKEKREGENEEEEEEHEEESEEKRGLLSFLPKVIGVIG HLIHPPS
|
| Length |
67 |
| Signal peptide class |
Class-1 |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
22 |
|
MASLKKSLFLVLFLGMVSLSIC |
| | |
| Prepro | | 24 | | DKEKREGENEEEEEEHEEESEEKR | | | | | Bioactive | Fallaxidin-4.1 | 21 | No | GLLSFLPKVIGVIGHLIHPPS | | | |
|