| Entry |
Nigrosin-2V |
| Uniprot code |
B7UEM2 |
| Fasta |
B7UEM2 |
| Peptide names |
Nigrosin-2V |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Odorrana |
| Species |
Odorrana versabilis |
| Ecozone |
Indomalaya |
| Distribution |
Southeastern China, from southern Anhui Jiangxi, and northern Guangdong west to Guizhou |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MFTLKKSMLLLFFLGTISLSLCEQERNADEEERRDEEVAKVEEIKRSILSGNFGVGKKIV
CGLSGLC
|
| Length |
67 |
| Signal peptide class |
Class-1 |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
22 |
|
MFTLKKSMLLLFFLGTISLSLC |
| | |
| Prepro | | 24 | | EQERNADEEERRDEEVAKVEEIKR | | | | | Bioactive | Nigrosin-2V | 21 | No | SILSGNFGVGKKIVCGLSGLC | | | |
|