| Entry |
Temporin-1CEa |
| Uniprot code |
B8QP36 |
| Fasta |
B8QP36 |
| Peptide names |
Temporin-1CEa |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Rana |
| Species |
Rana chensinensis |
| Ecozone |
Palearctic |
| Distribution |
Eastern Mongolia; north-central China (Shanxi) south to Sichuan and Hubei |
| Antimicrobial & other activities |
antibacterial, anticancer |
| Tissue |
Skin |
| Sequence |
MFTLKKSLLLLFFLGTINLSLCEEERDADEEERRDDPEERAVEVEKRFVDLKKIANIINS
IFGK
|
| Length |
64 |
| Signal peptide class |
Class-1 |
| References: |
| 2. for other activities |
D. Shang et al./ Zoological Science 26 (2009) 220-226. Molecular cloning of cDNAs encoding antimicrobial peptide precursors from the skin of the Chinese brown frog, Rana chensinensis |