| Entry |
Preprobrevinin-1CEb |
| Uniprot code |
B8QZV6 |
| Fasta |
B8QZV6 |
| Peptide names |
Preprobrevinin-1CEb Brevinin-1DYd Dybowskin-1 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Rana |
| Species |
Rana chensinensis |
| Ecozone |
Palearctic |
| Distribution |
Eastern Mongolia; north-central China (Shanxi) south to Sichuan and Hubei |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MFTLKKSLLLLFFLGTINLSLCEEERNADEEERRDDPDERAVEVEKRFLIGMTHGLICLI
SRKC
|
| Length |
64 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
S.S. Kim et al. / Peptides 28 (2007) 1532-1539. Purification and characterization of antimicrobial peptides from the skin secretion of Rana dybowskii |