| Entry |
Preprotemporin-1CEb |
| Uniprot code |
B8QZV9 |
| Fasta |
B8QZV9 |
| Peptide names |
Preprotemporin-1CEb Temporin-CDYb Amurin-3 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Rana |
| Species |
Rana chensinensis |
| Ecozone |
Palearctic |
| Distribution |
Eastern Mongolia; north-central China (Shanxi) south to Sichuan and Hubei |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MFTLKKSLLLLFFLGTINLSLCEEERNVDEERRDDPEERAVEVEKRILPILSLIGGLLGK
|
| Length |
60 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
Li-Li Jin et al. / Comparative Biochemistry and Physiology, Part B 154 (2009) 174-178. Characterization of antimicrobial peptides isolated from the skin of the Chinese frog, Rana dybowskii |