| Entry |
Nigroain-A |
| Uniprot code |
C0IL43 |
| Fasta |
C0IL43 |
| Peptide names |
Nigroain-A |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Hylarana |
| Species |
Hylarana nigrovittata |
| Ecozone |
Indomalaya |
| Distribution |
Nepal and West Bengal, Assam. and Meghalaya (India) as well as adjacent Bangladesh to Yunnan and Guangxi (China), Vietnam and south to Malaya |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MFTMKKSLLLLFFLGIVSLSLCGQERDADEEDGGEVTEEDEKRSALVGCWTKSYPPKPCF
GR
|
| Length |
62 |
| Signal peptide class |
Class-1 |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
22 |
|
MFTMKKSLLLLFFLGIVSLSLC |
| | |
| Prepro | | 21 | | GQERDADEEDGGEVTEEDEKR | | | | | Bioactive | Nigroain-A | 19 | No | SALVGCWTKSYPPKPCFGR | | | |
|