Entry |
Nigroain-A |
Uniprot code |
C0IL64 |
Fasta |
C0IL64 |
Peptide names |
Nigroain-A |
Suborder |
Neobatrachia |
Family |
Ranidae |
Genus |
Hylarana |
Species |
Hylarana nigrovittata |
Ecozone |
Indomalaya |
Distribution |
Nepal and West Bengal, Assam. and Meghalaya (India) as well as adjacent Bangladesh to Yunnan and Guangxi (China), Vietnam and south to Malaya |
Antimicrobial & other activities |
antibacterial |
Tissue |
Skin |
Sequence |
MFTMKKSLLLLFFLGIVSLSLCGQERDADEEDGGEVTEEEVKRSALVGCWTKS
|
Length |
53 |
Signal peptide class |
Class-1 |
Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
Signal |
|
22 |
|
MFTMKKSLLLLFFLGIVSLSLC |
| | |
Prepro | | 21 | | GQERDADEEDGGEVTEEEVKR | | | | Bioactive | Nigroain-A | 10 | No | SALVGCWTKS | | | |
|