Entry |
Nigroain-B |
Uniprot code |
C0IL69 |
Fasta |
C0IL69 |
Peptide names |
Nigroain-B Nigroain-B1 |
Suborder |
Neobatrachia |
Family |
Ranidae |
Genus |
Hylarana |
Species |
Hylarana nigrovittata |
Ecozone |
Indomalaya |
Distribution |
Nepal and West Bengal, Assam. and Meghalaya (India) as well as adjacent Bangladesh to Yunnan and Guangxi (China), Vietnam and south to Malaya |
Antimicrobial & other activities |
antibacterial, mast cell degranulation, histamine releasing |
Tissue |
Skin |
Sequence |
MFTMKKSLLLIFFLGIVSLSLCGQERDADEEDGGEATEQEERDVQRRCVISAGWNHKIRC KLTGNC
|
Length |
66 |
Signal peptide class |
Class-1 |
References: |
1. for MIC/HC50 |
Y. Ma et al. / Genomics 95 (2010) 66-71. Peptidomics and genomics analysis of novel antimicrobial peptides from the frog, Rana nigrovittata |
Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
Signal |
|
22 |
|
MFTMKKSLLLIFFLGIVSLSLC |
| | |
Prepro | | 25 | | GQERDADEEDGGEATEQEERDVQRR | | | | Bioactive | Nigroain-B | 19 | No | CVISAGWNHKIRCKLTGNC | | | 23.77 |
|