Entry |
Nigroain-C |
Uniprot code |
C0IL80 |
Fasta |
C0IL80 |
Peptide names |
Nigroain-C |
Suborder |
Neobatrachia |
Family |
Ranidae |
Genus |
Hylarana |
Species |
Hylarana nigrovittata |
Ecozone |
Indomalaya |
Distribution |
Nepal and West Bengal, Assam. and Meghalaya (India) as well as adjacent Bangladesh to Yunnan and Guangxi (China), Vietnam and south to Malaya |
Antimicrobial & other activities |
antibacterial, antifungal, mast cell degranulation |
Tissue |
Skin |
Sequence |
MFPMKKSLLLLFFLGVISLSLCKQKRHADEEGNEVSGGEAKVEEVKRFKTWKRPPFQTSC SGIIKE
|
Length |
66 |
Signal peptide class |
Class-1 |
Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
Signal |
|
22 |
|
MFPMKKSLLLLFFLGVISLSLC |
| | |
Prepro | | 25 | | KQKRHADEEGNEVSGGEAKVEEVKR | | | | Bioactive | Nigroain-C | 19 | No | FKTWKRPPFQTSCSGIIKE | | | |
|