Entry |
Gaegurin-6-RN |
Uniprot code |
C0ILG7 |
Fasta |
C0ILG7 |
Peptide names |
Gaegurin-6-RN Gaegurin-RN1 Gaegurin-GN1 |
Suborder |
Neobatrachia |
Family |
Ranidae |
Genus |
Hylarana |
Species |
Hylarana nigrovittata |
Ecozone |
Indomalaya |
Distribution |
Nepal and West Bengal, Assam. and Meghalaya (India) as well as adjacent Bangladesh to Yunnan and Guangxi (China), Vietnam and south to Malaya |
Antimicrobial & other activities |
antibacterial, antifungal, mast cell degranulation, histamine releasing |
Tissue |
Skin |
Sequence |
MFTMKKSLLLLFFLGTINLSFCEEERNAEEEKRDGDDEMDVEVQKRFIGPVLKIAAGILP TAICKIFKKC
|
Length |
70 |
Signal peptide class |
Class-1 |
References: |
1. for MIC/HC50 |
Y. Ma et al. / Genomics 95 (2010) 66-71. Peptidomics and genomics analysis of novel antimicrobial peptides from the frog, Rana nigrovittata |