| Entry |
Temporin-RN |
| Uniprot code |
C0ILJ6 |
| Fasta |
C0ILJ6 |
| Peptide names |
Temporin-RN Temporin-RN1 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Hylarana |
| Species |
Hylarana nigrovittata |
| Ecozone |
Indomalaya |
| Distribution |
Nepal and West Bengal, Assam. and Meghalaya (India) as well as adjacent Bangladesh to Yunnan and Guangxi (China), Vietnam and south to Malaya |
| Antimicrobial & other activities |
antibacterial, antifungal, mast cell degranulation, histamine releasing |
| Tissue |
Skin |
| Sequence |
MFTMKKSLLLLFFLGTINLSLCEEERNTEEEKRDGDDEGSVEMQKRFLPLVLGALSGILP KILGK
|
| Length |
65 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
Y. Ma et al. / Genomics 95 (2010) 66-71. Peptidomics and genomics analysis of novel antimicrobial peptides from the frog, Rana nigrovittata |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
22 |
|
MFTMKKSLLLLFFLGTINLSLC |
| | |
| Prepro | | 24 | | EEERNTEEEKRDGDDEGSVEMQKR | | | | | Bioactive | Temporin-RN | 17 | Yes | FLPLVLGALSGILPKIL | | | 2.66 |
|