| Entry |
Brevinin-2-RN |
| Uniprot code |
C0ILK3 |
| Fasta |
C0ILK3 |
| Peptide names |
Brevinin-2-RN Nigroain-K1 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Hylarana |
| Species |
Hylarana nigrovittata |
| Ecozone |
Indomalaya |
| Distribution |
Nepal and West Bengal, Assam. and Meghalaya (India) as well as adjacent Bangladesh to Yunnan and Guangxi (China), Vietnam and south to Malaya |
| Antimicrobial & other activities |
antibacterial, antifungal, mast cell degranulation |
| Tissue |
Skin |
| Sequence |
MFPMKKSLLLLFFLGFVSLSLCEQERGADEDEGEDIEEVKRSLWETIKNAGKGFIQNILD KIR
|
| Length |
63 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
Y. Ma et al. / Genomics 95 (2010) 66-71. Peptidomics and genomics analysis of novel antimicrobial peptides from the frog, Rana nigrovittata |