| Entry | Ranakinin-N bradykinin-like protein |
| Uniprot code | C0ILK6 |
| Fasta | C0ILK6 |
| Peptide names | Ranakinin-N bradykinin-like protein [Val1, Thr6]-Bradykinin Bradykinin |
| Suborder | Neobatrachia |
| Family | Ranidae |
| Genus | Hylarana |
| Species | Hylarana nigrovittata |
| Ecozone | Indomalaya |
| Distribution | Nepal and West Bengal, Assam. and Meghalaya (India) as well as adjacent Bangladesh to Yunnan and Guangxi (China), Vietnam and south to Malaya |
| Antimicrobial & other activities | contraction of intestinal smooth muscle, relaxation of arterial smooth muscle, targeting of bradykinin receptors (BDKRB) |
| Tissue | Skin |
| Sequence | MFTMKKSLLLLFFLGTISMSLCEEKRDADEEETEGEAKMEDIKRAEAVPPGFTPFRKP |
| Length | 58 |
| Signal peptide class | Class-1 |
| References: | |
| 2. for other activities | X. Liu et al. / Journal of Peptide Science 14 (2008) 626-630. A novel bradykinin-like peptide from skin secretions of the frog, Rana nigrovittata |
| Segment type | Name | Length | Amidated | Sequence | HC50 (μM) | MIC E. coli (μM) | MIC S. aureus (μM) |
| Signal | 22 | MFTMKKSLLLLFFLGTISMSLC | |||||
| Prepro | 22 | EEKRDADEEETEGEAKMEDIKR | |||||
| Bioactive | Ranakinin-N | 14 | No | AEAVPPGFTPFRKP |