| Entry | Maximin 28/H23 |
| Uniprot code | C3RSQ3 |
| Fasta | C3RSQ3 |
| Peptide names | Maximin 28 Maximin H23 Maximin 28/H23 |
| Suborder | Archeobatrachia |
| Family | Bombinatoridae |
| Genus | Bombina |
| Species | Bombina maxima |
| Ecozone | Palearctic, Indomalaya |
| Distribution | Yunnan, southwestern Sichuan, Hubei, Guizhou, and northern Guangxi, China; adjacent northern Vietnam |
| Antimicrobial & other activities | antibacterial, antifungal |
| Tissue | Skin, Brain |
| Sequence | MNFKYIVAVSFLIASAYARSEENDEQSLSQRDVLEEESLREIRGIGTKFLGGVKTALKGA LKELASTYVNGKRTAEDHEVMKRLEAVMRDLDSLDYPEEAAERETRGFNEEEIANLFTKK EKRILGPVISTIGNVLGGLLKNLG |
| Length | 144 |
| Signal peptide class | Class-3 |
| References: | |
| 1. for MIC/HC50 | R. Liu et al. / Journal of Proteome Research 10 (2011) 1806-1815. There are abundant antimicrobial peptides in brains of two kinds of Bombina toads |
| Segment type | Name | Length | Amidated | Sequence | HC50 (μM) | MIC E. coli (μM) | MIC S. aureus (μM) |
| Signal | 18 | MNFKYIVAVSFLIASAYA | |||||
| Prepro | 25 | RSEENDEQSLSQRDVLEEESLREIR | |||||
| Bioactive | Maximin 28 | 27 | Yes | GIGTKFLGGVKTALKGALKELASTYVN | 100 | 3.43 | 1.72 |
| Prepro | 53 | GKRTAEDHEVMKRLEAVMRDLDSLDYPEEAAERETRGFNEEEIANLFTKKEKR | |||||
| Bioactive | Maximin H23 | 20 | Yes | ILGPVISTIGNVLGGLLKNL |