| Entry | Maximin 63/H39 |
| Uniprot code | C3RSW2 |
| Fasta | C3RSW2 |
| Peptide names | Maximin 63 Maximin H39 Maximin 63/H39 |
| Suborder | Archeobatrachia |
| Family | Bombinatoridae |
| Genus | Bombina |
| Species | Bombina maxima |
| Ecozone | Palearctic, Indomalaya |
| Distribution | Yunnan, southwestern Sichuan, Hubei, Guizhou, and northern Guangxi, China; adjacent northern Vietnam |
| Antimicrobial & other activities | antibacterial; Maximin H39: antibacterial, antifungal |
| Tissue | Skin, Brain |
| Sequence | MNFKYIVAVSFLIASAYARSVQNDEQSLSQRDVLEEESLREIRGIGGVLLGAGKATLKGL AKVLAEKYANGKRTAEDHEVMKRLEAVMRDPDSLDHPEEASERETRGFNQDEIAKEKRIL GPVLGLVGNALGGLIKKLANYNQ |
| Length | 143 |
| Signal peptide class | Class-3 |
| References: | |
| 1. for MIC/HC50 | R. Liu et al. / Journal of Proteome Research 10 (2011) 1806-1815. There are abundant antimicrobial peptides in brains of two kinds of Bombina toads |
| Segment type | Name | Length | Amidated | Sequence | HC50 (μM) | MIC E. coli (μM) | MIC S. aureus (μM) |
| Signal | 18 | MNFKYIVAVSFLIASAYA | |||||
| Prepro | 25 | RSVQNDEQSLSQRDVLEEESLREIR | |||||
| Bioactive | Maximin 63 | 27 | Yes | GIGGVLLGAGKATLKGLAKVLAEKYAN | 100 | 7.2 | |
| Prepro | 48 | GKRTAEDHEVMKRLEAVMRDPDSLDHPEEASERETRGFNQDEIAKEKR | |||||
| Bioactive | Maximin H39 | 20 | Yes | ILGPVLGLVGNALGGLIKKL | 60 | 4.8 |