| Entry |
Lividin-2a |
| Uniprot code |
C3RSZ3 |
| Fasta |
C3RSZ3 |
| Peptide names |
Lividin-2a Brevinin-2-OR7 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Odorrana |
| Species |
Odorrana livida |
| Ecozone |
Indomalaya |
| Distribution |
Known definitely only from the type locality (Myanmar) near the Thai border, although animals have been referred, apparently in error, to this taxon, from northeastern India to southern China |
| Antimicrobial & other activities |
antibacterial, antifungal |
| Tissue |
Skin |
| Sequence |
MFTMKKSLLLLFFLGTISLSLCQEERGAEEDDGVEMTEEEVKRGLLDTIKNMALNAAKSA
GVSVLNTLSCKLSKTC
|
| Length |
76 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
X. Yang et al. / Journal of Proteome Research 11 (2012) 306-319. Extremely Abundant Antimicrobial Peptides Existed in the Skins of Nine Kinds of Chinese Odorous Frogs |